PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_36755g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 139aa    MW: 15316.2 Da    PI: 8.305
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_36755g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.43e-3272129260
    ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    ++vrY eC+kNhAas+Gg+avDGCgEfm+s geegtaaa+kCaAC+CHRnFHRre e+e
  MA_36755g0010  72 KGVRYGECRKNHAASIGGYAVDGCGEFMAS-GEEGTAAAMKCAACNCHRNFHRREAENE 129
                    579**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2272135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-3074126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.6E-2875125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.73376125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGLQIHTQVK DLGTGEFRSV FLHRRSEAPV TRSVQIQPQS ITAEEEMRLS ELGHQTEAAA  60
AATARRVIAS RKGVRYGECR KNHAASIGGY AVDGCGEFMA SGEEGTAAAM KCAACNCHRN  120
FHRREAENET LCDCHRIRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1048380.0BT104838.1 Picea glauca clone GQ02815_M01 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653170.18e-34PREDICTED: mini zinc finger protein 2-like
TrEMBLA9NYD84e-96A9NYD8_PICSI; Putative uncharacterized protein
STRINGVIT_08s0056g01130.t013e-33(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-31mini zinc finger 2